PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 219aa    MW: 23959.6 Da    PI: 6.6288
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19634genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.1e-1375120247
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                g+WT++E++ ++++ k  ++g Wk I+  + k+Rt+ q+ s+ qk+
  Tp57577_TGAC_v2_mRNA19634  75 GNWTEQEHKMFLKGLKHVPKGKWKQISTDFVKTRTPTQVASHAQKH 120
                                89******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.78669125IPR017930Myb domain
SMARTSM007173.2E-873123IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-1473125IPR009057Homeodomain-like
PfamPF002492.3E-1075120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-975120IPR009057Homeodomain-like
CDDcd001673.69E-876121No hitNo description
TIGRFAMsTIGR015571.0E-1276122IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MSTSNDGGEN SIMIFGVKVS RGINNNNTNT TTNNNLAQYQ QPPPQVSSST DASNVSDNVA  60
DASVGSHECK RVNEGNWTEQ EHKMFLKGLK HVPKGKWKQI STDFVKTRTP TQVASHAQKH  120
FLLQANQNRR RRGKFSVFDL TIDEEVGSST TMEDKQIQQE IVVPLPPPTP TAIPSTHNGS  180
ISDHSLSTGL CPVALPMLPP WIDLNDNESS YAENFSLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489945.14e-56PREDICTED: transcription factor MYB1R1-like
RefseqXP_012568256.14e-56PREDICTED: transcription factor MYB1R1-like
TrEMBLG7K6Z91e-43G7K6Z9_MEDTR; MYB-like transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.29e-29MYB_related family protein